Recombinant Human LIR-1 (LILRB1), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human LIR-1 (LILRB1), partial, Biotinylated
• Artikelnummer: CSB-MP5114HU-B
• Hersteller Artikelnummer: CSB-MP5114HU-B
• Alternativnummer: CSB-MP5114HU-B-1, CSB-MP5114HU-B-100, CSB-MP5114HU-B-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 76.7 kDa
• Tag: C-terminal hFc-Avi-tagged
• UniProt: D9IDM8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 24-458aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGL