Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5),partial (Active)

Produktübersicht

• Artikelname: Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5),partial (Active)
• Artikelnummer: CSB-MP5152MOW
• Hersteller Artikelnummer: CSB-MP5152MOW
• Alternativnummer: CSB-MP5152MOW-1, CSB-MP5152MOW-100, CSB-MP5152MOW-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 76.9 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: XP_005589491.1
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Mammalian cell
• Expression System: 1-685aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGEN

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration