Recombinant Human Guanylate cyclase activator 2B (GUCA2B)
Artikelnummer:
CSB-MP613693HU
- Bilder (0)
| Artikelname: | Recombinant Human Guanylate cyclase activator 2B (GUCA2B) |
| Artikelnummer: | CSB-MP613693HU |
| Hersteller Artikelnummer: | CSB-MP613693HU |
| Alternativnummer: | CSB-MP613693HU-1, CSB-MP613693HU-100, CSB-MP613693HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Guanylate cyclase C-activating peptide II ,GCAP-IIUroguanylin ,UGN,CSB-PR2024 |
| Molekulargewicht: | 13.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q16661 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 27-112aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
Produktgarantie und fachkundiger Support
