Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial

Artikelnummer: CSB-MP619640HU
Artikelname: Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial
Artikelnummer: CSB-MP619640HU
Hersteller Artikelnummer: CSB-MP619640HU
Alternativnummer: CSB-MP619640HU-1, CSB-MP619640HU-100, CSB-MP619640HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Glycoprotein GP36b)(Lectin mannose-binding 2)(Vesicular integral-membrane protein 36)(VIP36),CSB-PR2024
Molekulargewicht: 36.0 kDa
Tag: N-terminal 6xHis-HA-tagged
UniProt: Q12907
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 45-322aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNF