Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Produktübersicht

• Artikelname: Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)
• Artikelnummer: CSB-MP620956HUD9
• Hersteller Artikelnummer: CSB-MP620956HUd9
• Alternativnummer: CSB-MP620956HUD9-1, CSB-MP620956HUD9-100, CSB-MP620956HUD9-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (IBP-7)(IGF-binding protein 7)(IGFBP-7)(IGFBP-rP1)(MAC25 protein)(PGI2-stimulating factor)(Prostacyclin-stimulating factor)(Tumor-derived adhesion factor)(TAF),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 55.4 kDa
• Tag: C-terminal hFc-tagged
• UniProt: Q16270
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 27-282aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGA