Recombinant Human Frizzled-2 (FZD2), partial

Produktübersicht

• Artikelname: Recombinant Human Frizzled-2 (FZD2), partial
• Artikelnummer: CSB-MP622766HU2
• Hersteller Artikelnummer: CSB-MP622766HU2
• Alternativnummer: CSB-MP622766HU2-1, CSB-MP622766HU2-100, CSB-MP622766HU2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Fz-2,hFz2,FzE2

Produkteigenschaften

• Molekulargewicht: 46.9 kDa
• Tag: C-terminal hFc-tagged
• UniProt: Q14332
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 24-190aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPP