Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial
Artikelnummer:
CSB-MP623930HU
- Bilder (0)
| Artikelname: | Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial |
| Artikelnummer: | CSB-MP623930HU |
| Hersteller Artikelnummer: | CSB-MP623930HU |
| Alternativnummer: | CSB-MP623930HU-1, CSB-MP623930HU-100, CSB-MP623930HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | DIP2 homolog A,CSB-PR2024 |
| Molekulargewicht: | 42.2 kDa |
| Tag: | C-terminal hFC-tagged |
| UniProt: | Q14689 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 9-127aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS |
Produktgarantie und fachkundiger Support
