Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1),partial

Produktübersicht

• Artikelname: Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1),partial
• Artikelnummer: CSB-MP689809HU
• Hersteller Artikelnummer: CSB-MP689809HU
• Alternativnummer: CSB-MP689809HU-1, CSB-MP689809HU-100, CSB-MP689809HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (CCP module-containing protein 22)(Polydom)(Selectin-like osteoblast-derived protein)(SEL-OB)(Serologically defined breast cancer antigen NY-BR-38)

Produkteigenschaften

• Molekulargewicht: 39.5 kDa
• Tag: C-terminal hFc-tagged
• UniProt: Q4LDE5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 736-827aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG