Recombinant Human Mucin-16 (MUC16), partial
Artikelnummer:
CSB-MP704410HU3
- Bilder (0)
| Artikelname: | Recombinant Human Mucin-16 (MUC16), partial |
| Artikelnummer: | CSB-MP704410HU3 |
| Hersteller Artikelnummer: | CSB-MP704410HU3 |
| Alternativnummer: | CSB-MP704410HU3-1, CSB-MP704410HU3-100, CSB-MP704410HU3-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Ovarian cancer-related tumor marker CA125 (CA-125) (Ovarian carcinoma antigen CA125) |
| Molekulargewicht: | 58.5 kDa |
| Tag: | C-terminal FC-Myc-tagged |
| UniProt: | Q8WXI7 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 12660-12923aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLR |
Produktgarantie und fachkundiger Support
