Recombinant Human Inducible T-cell costimulator (ICOS), partial

Produktübersicht

• Artikelname: Recombinant Human Inducible T-cell costimulator (ICOS), partial
• Artikelnummer: CSB-MP707478HU
• Hersteller Artikelnummer: CSB-MP707478HU
• Alternativnummer: CSB-MP707478HU-1, CSB-MP707478HU-100, CSB-MP707478HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Activation-inducible lymphocyte immunomediatory molecule

Produkteigenschaften

• Molekulargewicht: 42.7 kDa
• Tag: C-terminal hFc-tagged
• UniProt: Q9Y6W8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 21-141aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF