Recombinant Mouse Lymphocyte activation gene 3 protein (Lag3), partial
Artikelnummer:
CSB-MP720261MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Lymphocyte activation gene 3 protein (Lag3), partial |
| Artikelnummer: | CSB-MP720261MO |
| Hersteller Artikelnummer: | CSB-MP720261MO |
| Alternativnummer: | CSB-MP720261MO-1, CSB-MP720261MO-100, CSB-MP720261MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | LAG-3,Activation-induced cytidine deaminase-linked autoimmunity protein,Aida,CD antigen CD223,sLAG-3 |
| Molekulargewicht: | 46.6 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q61790 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 24-442aa |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCH |
Produktgarantie und fachkundiger Support
