Recombinant Mouse Ubiquitin-like protein ISG15 (Isg15)
Artikelnummer:
CSB-MP723739MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Ubiquitin-like protein ISG15 (Isg15) |
| Artikelnummer: | CSB-MP723739MO |
| Hersteller Artikelnummer: | CSB-MP723739MO |
| Alternativnummer: | CSB-MP723739MO-1, CSB-MP723739MO-100, CSB-MP723739MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Interferon-induced 15 kDa protein)(Interferon-induced 17 kDa protein)(IP17)(Ubiquitin cross-reactive protein) |
| Molekulargewicht: | 19.2 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q64339 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 1-155aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG |
Produktgarantie und fachkundiger Support
