Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial
Artikelnummer:
CSB-MP723744MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial |
| Artikelnummer: | CSB-MP723744MO |
| Hersteller Artikelnummer: | CSB-MP723744MO |
| Alternativnummer: | CSB-MP723744MO-1, CSB-MP723744MO-100, CSB-MP723744MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II) |
| Molekulargewicht: | 29.5 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q64514 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 44-264aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
Produktgarantie und fachkundiger Support
