Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)

Produktübersicht

• Artikelname: Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)
• Artikelnummer: CSB-RP001144H
• Hersteller Artikelnummer: CSB-RP001144h
• Alternativnummer: CSB-RP001144H-1, CSB-RP001144H-100, CSB-RP001144H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nuclear factor of activated T-cells 45KDA

Produkteigenschaften

• Molekulargewicht: 70.1 kDa
• Tag: N-terminal GST-tagged
• UniProt: Q12905
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-390aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVM