Recombinant Human Death-associated protein 1 (DAP)

Produktübersicht

• Artikelname: Recombinant Human Death-associated protein 1 (DAP)
• Artikelnummer: CSB-RP010344H
• Hersteller Artikelnummer: CSB-RP010344h
• Alternativnummer: CSB-RP010344H-1, CSB-RP010344H-100, CSB-RP010344H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: DAP 1, Dap, DAP-1, DAP1_HUMAN, Death associated protein 1, Death associated protein, Death-associated protein 1, MGC99796, OTTHUMP00000161670, OTTHUMP00000221331

Produkteigenschaften

• Molekulargewicht: 38 kDa
• Tag: N-terminal GST-tagged
• UniProt: P51397
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 2-102aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK