Recombinant Human Death domain-associated protein 6 (DAXX), partial

Artikelnummer: CSB-RP012444H
Artikelname: Recombinant Human Death domain-associated protein 6 (DAXX), partial
Artikelnummer: CSB-RP012444H
Hersteller Artikelnummer: CSB-RP012444h
Alternativnummer: CSB-RP012444H-1, CSB-RP012444H-100, CSB-RP012444H-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Daxx ,hDaxxETS1-associated protein 1 ,EAP1Fas death domain-associated protein
Molekulargewicht: 52.7 kDa
Tag: N-terminal GST-tagged
UniProt: Q9UER7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-233aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLI