Recombinant Human Proteasome subunit beta type-1 (PSMB1)

Produktübersicht

• Artikelname: Recombinant Human Proteasome subunit beta type-1 (PSMB1)
• Artikelnummer: CSB-RP013954H
• Hersteller Artikelnummer: CSB-RP013954h
• Alternativnummer: CSB-RP013954H-1, CSB-RP013954H-100, CSB-RP013954H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Macropain subunit C5Multicatalytic endopeptidase complex subunit C5Proteasome component C5Proteasome gamma chain

Produkteigenschaften

• Molekulargewicht: 50.5 kDa
• Tag: N-terminal GST-tagged
• UniProt: P20618
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 29-241aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD