Recombinant Human X-ray repair cross-complementing protein 6 (XRCC6), partial

Produktübersicht

• Artikelname: Recombinant Human X-ray repair cross-complementing protein 6 (XRCC6), partial
• Artikelnummer: CSB-RP016174H
• Hersteller Artikelnummer: CSB-RP016174h
• Alternativnummer: CSB-RP016174H-1, CSB-RP016174H-100, CSB-RP016174H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 5-deoxyribose-5-phosphate lyase Ku70 ,5-dRP lyase Ku7070KDA subunit of Ku antigen,ATP-dependent DNA helicase 2 subunit 1ATP-dependent DNA helicase II 70KDA subunitCTC box-binding factor 75KDA subunit ,CTC75 ,CTCBFDNA repair protein XR,CC6Lupus Ku autoant

Produkteigenschaften

• Molekulargewicht: 28.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P12956
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 6-222aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIIS