Recombinant Human Alpha-endosulfine (ENSA)

Produktübersicht

• Artikelname: Recombinant Human Alpha-endosulfine (ENSA)
• Artikelnummer: CSB-RP017044H
• Hersteller Artikelnummer: CSB-RP017044h
• Alternativnummer: CSB-RP017044H-1, CSB-RP017044H-100, CSB-RP017044H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ARPP-19e

Produkteigenschaften

• Molekulargewicht: 40.4 kDa
• Tag: N-terminal GST-tagged
• UniProt: O43768
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-121aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE