Recombinant Human Transcription factor BTF3 (BTF3), partial
Artikelnummer:
CSB-RP017144H
- Bilder (0)
| Artikelname: | Recombinant Human Transcription factor BTF3 (BTF3), partial |
| Artikelnummer: | CSB-RP017144H |
| Hersteller Artikelnummer: | CSB-RP017144h |
| Alternativnummer: | CSB-RP017144H-1, CSB-RP017144H-100, CSB-RP017144H-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Nascent polypeptide-associated complex subunit beta ,NAC-betaRNA polymerase B transcription factor 3 |
| Molekulargewicht: | 44.3 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P20290 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 48-206aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN |
Produktgarantie und fachkundiger Support
