Recombinant Human 60S ribosomal protein L36a-like (RPL36AL)
Artikelnummer:
CSB-RP018044H
- Bilder (0)
| Artikelname: | Recombinant Human 60S ribosomal protein L36a-like (RPL36AL) |
| Artikelnummer: | CSB-RP018044H |
| Hersteller Artikelnummer: | CSB-RP018044h |
| Alternativnummer: | CSB-RP018044H-1, CSB-RP018044H-100, CSB-RP018044H-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like |
| Molekulargewicht: | 39.5 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q969Q0 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-106aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF |
Produktgarantie und fachkundiger Support
