Recombinant Human Zinc finger protein 91 (ZNF91), partial

Artikelnummer: CSB-RP020054H
Artikelname: Recombinant Human Zinc finger protein 91 (ZNF91), partial
Artikelnummer: CSB-RP020054H
Hersteller Artikelnummer: CSB-RP020054h
Alternativnummer: CSB-RP020054H-1, CSB-RP020054H-100, CSB-RP020054H-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Membrane-bound C2 domain-containing protein
Molekulargewicht: 51.4 kDa
Tag: N-terminal GST-tagged
UniProt: Q05481
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-208aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPDLITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENLQLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKKCFKCKKCVKSFCIRLHKTQHKCVYITEK