Recombinant Human Rhombotin-1 (LMO1), partial

Produktübersicht

• Artikelname: Recombinant Human Rhombotin-1 (LMO1), partial
• Artikelnummer: CSB-RP020544H
• Hersteller Artikelnummer: CSB-RP020544h
• Alternativnummer: CSB-RP020544H-1, CSB-RP020544H-100, CSB-RP020544H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cysteine-rich protein TTG-1LIM domain only protein 1 ,LMO-1T-cell translocation protein 1

Produkteigenschaften

• Molekulargewicht: 44.4 kDa
• Tag: N-terminal GST-tagged
• UniProt: P25800
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 5-156aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ