Recombinant Human 14-3-3 protein eta (YWHAH), partial

Produktübersicht

• Artikelname: Recombinant Human 14-3-3 protein eta (YWHAH), partial
• Artikelnummer: CSB-RP021744H
• Hersteller Artikelnummer: CSB-RP021744h
• Alternativnummer: CSB-RP021744H-1, CSB-RP021744H-100, CSB-RP021744H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein AS1,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 54.9 kDa
• Tag: N-terminal GST-tagged
• UniProt: Q04917
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 4-246aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN