Recombinant Human 40S ribosomal protein S10 (RPS10), partial
Artikelnummer:
CSB-RP025654H
- Bilder (0)
| Artikelname: | Recombinant Human 40S ribosomal protein S10 (RPS10), partial |
| Artikelnummer: | CSB-RP025654H |
| Hersteller Artikelnummer: | CSB-RP025654h |
| Alternativnummer: | CSB-RP025654H-1, CSB-RP025654H-100, CSB-RP025654H-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 40S ribosomal protein S10, DBA9, MGC88819, OTTHUMP00000016229, OTTHUMP00000016230, RPS10, RS10_HUMAN, S10 |
| Molekulargewicht: | 45.5 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P46783 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 4-165aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ |
Produktgarantie und fachkundiger Support
