Recombinant Human Enhancer of rudimentary homolog (ERH)
Artikelnummer:
CSB-RP027444H
- Bilder (0)
| Artikelname: | Recombinant Human Enhancer of rudimentary homolog (ERH) |
| Artikelnummer: | CSB-RP027444H |
| Hersteller Artikelnummer: | CSB-RP027444h |
| Alternativnummer: | CSB-RP027444H-1, CSB-RP027444H-100, CSB-RP027444H-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | DROER, Enhancer of rudimentary homolog (Drosophila), Enhancer of rudimentary homolog, ERH, ERH_HUMAN, FLJ27340, HGNC:3447 |
| Molekulargewicht: | 39.1 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P84090 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 2-104aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
Produktgarantie und fachkundiger Support
