Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial
Artikelnummer:
CSB-RP033244H
- Bilder (0)
| Artikelname: | Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial |
| Artikelnummer: | CSB-RP033244H |
| Hersteller Artikelnummer: | CSB-RP033244h |
| Alternativnummer: | CSB-RP033244H-1, CSB-RP033244H-100, CSB-RP033244H-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Arp2/3 complex 21KDA subunit ,p21-AR,C |
| Molekulargewicht: | 47.1 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | O15145 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 2-175aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG |
Produktgarantie und fachkundiger Support
