Recombinant Nosema bombycis Polar tube protein 3 (PTP3), partial Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Nosema bombycis Polar tube protein 3 (PTP3), partial Preis auf Anfrage
• Artikelnummer: CSB-RP125444H
• Hersteller Artikelnummer: CSB-RP125444h
• Alternativnummer: CSB-RP125444H-1,CSB-RP125444H-100,CSB-RP125444H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 95.9 kDa
• Tag: N-terminal GST-tagged
• UniProt: R0KX08
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 700-1331aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EIKSVIPEDRDEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENSKKIHIDEATAYFKPAAKLKMEKKGIKTDNFRPKTNQGEIRDMPKGETYYEVDLKDADLSLPSPTNPTPDTLVSNGKDVVDVEDVSAIVINKGTLVQTPWNEYSDMIKPKFNPYPNEGEKINQIKKLQKLIADEKRKDTLDRIKVNTITNPDGEKRMIVNTPYGVQEMFEETEGM