Recombinant Lemna minor ATP synthase subunit beta, chloroplastic (atpB) Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Lemna minor ATP synthase subunit beta, chloroplastic (atpB) Preis auf Anfrage
• Artikelnummer: CSB-RP139994PL
• Hersteller Artikelnummer: CSB-RP139994Pl
• Alternativnummer: CSB-RP139994PL-1,CSB-RP139994PL-100,CSB-RP139994PL-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ATP synthase F1 sector subunit beta

Produkteigenschaften

• Molekulargewicht: 57.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: A9L9A3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-497aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MQINPTTSGTAVSQLEEKNLGRVAQIIGPVLDVVFPPGKMPNIYNALVVKGQDADGQEIKVTCEVQQLLGNNRVRAVAMSATDGLTRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLAIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNITESKVALVYGQMNEPPGARMRVGLTAL