Recombinant Bovine Angiogenin-1 (ANG1)

Produktübersicht

• Artikelname: Recombinant Bovine Angiogenin-1 (ANG1)
• Artikelnummer: CSB-RP146794B
• Hersteller Artikelnummer: CSB-RP146794B
• Alternativnummer: CSB-RP146794B-1, CSB-RP146794B-100, CSB-RP146794B-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ANG1, ANGAngiogenin-1, EC 3.1.27.-

Produkteigenschaften

• Molekulargewicht: 18.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P10152
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 24-148aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH