Recombinant Human Glutamyl aminopeptidase (ENPEP), partial

Produktübersicht

• Artikelname: Recombinant Human Glutamyl aminopeptidase (ENPEP), partial
• Artikelnummer: CSB-RP147594H(C)
• Hersteller Artikelnummer: CSB-RP147594h(c)
• Alternativnummer: CSB-RP147594H(C)-1, CSB-RP147594H(C)-100, CSB-RP147594H(C)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Aminopeptidase A ,AP-ADifferentiation antigen gp160, CD249,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 31 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q07075
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 719-949aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW