Recombinant Human Glutamyl aminopeptidase (ENPEP), partial Preis auf Anfrage

Artikelnummer: CSB-RP147594H(C)
Artikelname: Recombinant Human Glutamyl aminopeptidase (ENPEP), partial Preis auf Anfrage
Artikelnummer: CSB-RP147594H(C)
Hersteller Artikelnummer: CSB-RP147594h(c)
Alternativnummer: CSB-RP147594H(C)-1,CSB-RP147594H(C)-100,CSB-RP147594H(C)-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Aminopeptidase A ,AP-ADifferentiation antigen gp160, CD249
Molekulargewicht: 31 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q07075
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 719-949aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW