Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1),partial
Artikelnummer:
CSB-RP148194H
- Bilder (0)
| Artikelname: | Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1),partial |
| Artikelnummer: | CSB-RP148194H |
| Hersteller Artikelnummer: | CSB-RP148194h |
| Alternativnummer: | CSB-RP148194H-1, CSB-RP148194H-100, CSB-RP148194H-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | DP(W3)DP(W4)HLA-SB alpha chain,MHC class II DP3-alphaMHC class II DPA1 |
| Molekulargewicht: | 26.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P20036 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 29-222aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE |
Produktgarantie und fachkundiger Support
