Recombinant Human HLA class I histocompatibility antigen, C alpha chain (HLA-C),partial

Produktübersicht

• Artikelname: Recombinant Human HLA class I histocompatibility antigen, C alpha chain (HLA-C),partial
• Artikelnummer: CSB-RP150994H
• Hersteller Artikelnummer: CSB-RP150994h
• Alternativnummer: CSB-RP150994H-1, CSB-RP150994H-100, CSB-RP150994H-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 36.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O78179
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 25-308aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEE