Recombinant Rat Vesicle-fusing ATPase (Nsf), partial Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Rat Vesicle-fusing ATPase (Nsf), partial Preis auf Anfrage
• Artikelnummer: CSB-RP154574R(N)
• Hersteller Artikelnummer: CSB-RP154574r(N)
• Alternativnummer: CSB-RP154574R(N)-1,CSB-RP154574R(N)-100,CSB-RP154574R(N)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: N-ethylmaleimide-sensitive fusion protein ,NEM-sensitive fusion proteinVesicular-fusion protein NSF

Produkteigenschaften

• Molekulargewicht: 26.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9QUL6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 7-209aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII