Recombinant Human Caspase-7 (CASP7), partial

Produktübersicht

• Artikelname: Recombinant Human Caspase-7 (CASP7), partial
• Artikelnummer: CSB-RP154794H(A3)
• Hersteller Artikelnummer: CSB-RP154794h(A3)
• Alternativnummer: CSB-RP154794H(A3)-1, CSB-RP154794H(A3)-100, CSB-RP154794H(A3)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ,ICE-LAP3

Produkteigenschaften

• Molekulargewicht: 23.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P55210
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 24-198aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQAD