Recombinant Rat Retinoblastoma-associated protein (Rb1), partial

Produktübersicht

• Artikelname: Recombinant Rat Retinoblastoma-associated protein (Rb1), partial
• Artikelnummer: CSB-RP155294R(A3)
• Hersteller Artikelnummer: CSB-RP155294r(A3)
• Alternativnummer: CSB-RP155294R(A3)-1, CSB-RP155294R(A3)-100, CSB-RP155294R(A3)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: pRb ,Rbpp105

Produkteigenschaften

• Molekulargewicht: 26.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P33568
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 721-919aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTRTRMQKQKLNDSMEISNKEE