Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial
Artikelnummer:
CSB-RP156244R
- Bilder (0)
| Artikelname: | Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial |
| Artikelnummer: | CSB-RP156244R |
| Hersteller Artikelnummer: | CSB-RP156244r |
| Alternativnummer: | CSB-RP156244R-1, CSB-RP156244R-100, CSB-RP156244R-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor |
| Molekulargewicht: | 31.9 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P30560 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 7-52aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK |
Produktgarantie und fachkundiger Support
