Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R), partial

Produktübersicht

• Artikelname: Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R), partial
• Artikelnummer: CSB-YP011093BO
• Hersteller Artikelnummer: CSB-YP011093BO
• Alternativnummer: CSB-YP011093BO-1, CSB-YP011093BO-100, CSB-YP011093BO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannose 6-phosphate receptor)(MPR 300)(Insulin-like growth factor 2 receptor)(Insulin-like growth factor II receptor)(IGF-II receptor)(CD antigen CD222),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 17.1 kDa
• Tag: Tag-Free
• UniProt: P08169
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 628-772aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP