Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R), partial
Artikelnummer:
CSB-YP011093BOC7
- Bilder (0)
| Artikelname: | Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R), partial |
| Artikelnummer: | CSB-YP011093BOC7 |
| Hersteller Artikelnummer: | CSB-YP011093BOc7 |
| Alternativnummer: | CSB-YP011093BOC7-1, CSB-YP011093BOC7-100, CSB-YP011093BOC7-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannose 6-phosphate receptor)(MPR 300)(Insulin-like growth factor 2 receptor)(Insulin-like growth factor II receptor)(IGF-II receptor)(CD antigen CD222) |
| Molekulargewicht: | 18.2 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P08169 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 628-772aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Produktgarantie und fachkundiger Support
