Recombinant Human Immunoglobulin lambda constant 1 (IGLC1)
Artikelnummer:
CSB-YP011452HU
- Bilder (0)
| Artikelname: | Recombinant Human Immunoglobulin lambda constant 1 (IGLC1) |
| Artikelnummer: | CSB-YP011452HU |
| Hersteller Artikelnummer: | CSB-YP011452HU |
| Alternativnummer: | CSB-YP011452HU-1, CSB-YP011452HU-100, CSB-YP011452HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Ig lambda chain C region MGC)(Ig lambda-1 chain C region),CSB-PR2024 |
| Molekulargewicht: | 13.4 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | P0CG04 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-106aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
Produktgarantie und fachkundiger Support
