Recombinant Bovine Interleukin-10 (IL10)

Produktübersicht

• Artikelname: Recombinant Bovine Interleukin-10 (IL10)
• Artikelnummer: CSB-YP011580BO
• Hersteller Artikelnummer: CSB-YP011580BO
• Alternativnummer: CSB-YP011580BO-1, CSB-YP011580BO-100, CSB-YP011580BO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cytokine synthesis inhibitory factor ,CSIF

Produkteigenschaften

• Molekulargewicht: 20.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P43480
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 19-178aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK