Recombinant Human Interleukin-1 alpha (IL1A)

Produktübersicht

• Artikelname: Recombinant Human Interleukin-1 alpha (IL1A)
• Artikelnummer: CSB-YP011613HU
• Hersteller Artikelnummer: CSB-YP011613HU
• Alternativnummer: CSB-YP011613HU-1, CSB-YP011613HU-100, CSB-YP011613HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Hematopoietin-1 (IL-1 alpha) (IL1F1)

Produkteigenschaften

• Molekulargewicht: 20.0 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P01583
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 113-271aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA