Recombinant Macaca fascicularis Interleukin-1 alpha (IL1A)

Produktübersicht

• Artikelname: Recombinant Macaca fascicularis Interleukin-1 alpha (IL1A)
• Artikelnummer: CSB-YP011613MOV
• Hersteller Artikelnummer: CSB-YP011613MOV
• Alternativnummer: CSB-YP011613MOV-1, CSB-YP011613MOV-100, CSB-YP011613MOV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (IL-1 alpha)(Hematopoietin-1),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 21.9 kDa
• Tag: C-terminal 6xHis-Myc-tagged
• UniProt: P79340
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 113-271aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA