Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial

Produktübersicht

• Artikelname: Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial
• Artikelnummer: CSB-YP012070HU
• Hersteller Artikelnummer: CSB-YP012070HU
• Alternativnummer: CSB-YP012070HU-1, CSB-YP012070HU-100, CSB-YP012070HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1

Produkteigenschaften

• Molekulargewicht: 17.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O95069
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-143aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD