Recombinant Human Kinesin light chain 3 (KLC3)

Artikelnummer: CSB-YP012381HU
Artikelname: Recombinant Human Kinesin light chain 3 (KLC3)
Artikelnummer: CSB-YP012381HU
Hersteller Artikelnummer: CSB-YP012381HU
Alternativnummer: CSB-YP012381HU-1, CSB-YP012381HU-100, CSB-YP012381HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: KLC2-like kinesin light chain 2
Molekulargewicht: 57.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q6P597
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 1-504aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNI