Recombinant Human Neural cell adhesion molecule L1 protein (L1CAM), partial

Produktübersicht

• Artikelname: Recombinant Human Neural cell adhesion molecule L1 protein (L1CAM), partial
• Artikelnummer: CSB-YP012704HU
• Hersteller Artikelnummer: CSB-YP012704HU
• Alternativnummer: CSB-YP012704HU-1, CSB-YP012704HU-100, CSB-YP012704HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CD171

Produkteigenschaften

• Molekulargewicht: 14.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P32004
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1003-1114aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP