Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2)
Artikelnummer:
CSB-YP012855MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2) |
| Artikelnummer: | CSB-YP012855MO |
| Hersteller Artikelnummer: | CSB-YP012855MO |
| Alternativnummer: | CSB-YP012855MO-1, CSB-YP012855MO-100, CSB-YP012855MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | LECT-2,Chondromodulin II,ChM-II |
| Molekulargewicht: | 18.4 kDa |
| Tag: | C-terminal 6xHis-Myc-tagged |
| UniProt: | O88803 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 19-151aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL |
Produktgarantie und fachkundiger Support
