Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial

Produktübersicht

• Artikelname: Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial
• Artikelnummer: CSB-YP012906HU
• Hersteller Artikelnummer: CSB-YP012906HU
• Alternativnummer: CSB-YP012906HU-1, CSB-YP012906HU-100, CSB-YP012906HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: G-protein coupled receptor 49G-protein coupled receptor 67G-protein coupled receptor HG38

Produkteigenschaften

• Molekulargewicht: 62.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O75473
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 22-561aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEK