Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial

Artikelnummer: CSB-YP012941MO
Artikelname: Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial
Artikelnummer: CSB-YP012941MO
Hersteller Artikelnummer: CSB-YP012941MO
Alternativnummer: CSB-YP012941MO-1, CSB-YP012941MO-100, CSB-YP012941MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Cell-surface glycoprotein p91,Paired immunoglobulin-like receptor B ,PIR-B
Molekulargewicht: 21.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P97484
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 664-841aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ